Commit b6ceb567 authored by B13nch3n's avatar B13nch3n
Browse files

Registry based images

parent 93ca5d54
......@@ -46,4 +46,6 @@ CATHSMAPI_CODEBASE=fromlocal
# the Git repository
#CATHSMAPI_GITTAG=v0.0.1
DOCKER_REGISTRY=registry.scicore.unibas.ch/bienert/cathsm-server-sibdays2020ed
ALLOWED_HOSTS=localhost,127.0.0.1
\ No newline at end of file
......@@ -12,13 +12,6 @@ version: "3.5"
# spawned from a '.env' file. This file needs to be in the same
# directory as the docker-compose command is run. Variables in this
# file are defined by '<VARIABLE NAME>=<VALUE>'.
#
# For convenience, a template `.env` file has been included in this
# repository (called `.env.template`). The easiest way to copy this
# template then change the values for each variable locally.
#
# $ cp .env.template .env
# $ vi .env
volumes:
db-store:
......@@ -28,6 +21,7 @@ volumes:
services:
cathapi-redis:
restart: always
image: $DOCKER_REGISTRY/cathapi-redis
build:
context: ./redis/
networks:
......@@ -37,6 +31,7 @@ services:
cathapi-django:
restart: always
image: $DOCKER_REGISTRY/cathapi-django
build:
context: ../
dockerfile: Docker/cathapi/Dockerfile
......
>Target
VLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGKKVADALTKAVGH
LDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPSVHASLDKFLASVSTVLTSKYR
>HBB_PHYCD P09905 Hemoglobin subunit beta-1/2
VHLTGEEKSGLTALWAKVNVEEIGGEALGRLLVVYPWTQRFFEHFGDLSTADAVMKNPKVKKHGQKVLASFG
EGLKHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKEFTPELQTAYQKVVAGVANALAHK
YH
>sp|P0DTC7|NS7A_SARS2 ORF7a protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7a PE=1 SV=1
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFS
TQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKT
E
>sp|P61851|SODC_DROME
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSG
PHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHA
DADDLGQGGHELSKSTGNAGARIGCGVIGIAKV
[sibdays2020@theb-si.de::http://localhost:80]
api_token = d76afaba0d07F19a9ad66bDb8e71024ce6f9a81f
[sibdays2020@theb-si.de::https://beta.swissmodel.expasy.org]
api_token = adc218a00286a91f89a549cbef3d189e2e5dd0b8
>Target
SNAGNSTTSDKGTEEATTSAFDVMSQFNEIGVSYPLTVTDQAGRTVTFEKAPEKIASSYYISTSLLLALGLQ
DKLVGIEAKANTRNIYKLAAPAIVSLPNMGTAKEFNTEACVAATPDVVFLPMKLKKTADTLESLGIKAVVVN
PEDQSLLEECITLVGKITNNAGRAEALNNSIKTFLADNKTNVSGGNTPSVYLAGNSSVLSTAGSKMYQNTLL
TNAGGKNVASELTDTYWANVSYEQILAWNPDYIVIAADATYTVDDILNDANLAGCNAVKNKNVVKLPNNIEA
WDSPVPGSFLGSIYIASVLHPEKVTKDFYETCVTKFYESFYGFTPAK
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment